PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L01092.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family G2-like
Protein Properties Length: 333aa    MW: 36013.9 Da    PI: 8.2372
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L01092.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.3e-31177232156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k+r++W+peLH+rF++a++qLGG ++ tPk+i+elmkv+gLt+++vkSHLQkYRl+
  Migut.L01092.1.p 177 KARRCWSPELHRRFLQAIQQLGGGHVGTPKQIRELMKVDGLTNDEVKSHLQKYRLH 232
                       68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.06174234IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-28174235IPR009057Homeodomain-like
SuperFamilySSF466893.32E-17175235IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26177232IPR006447Myb domain, plants
PfamPF002498.3E-9179230IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MQKCNDYIHA LEEERSKIQV FQRDLPLCLD LVTQAIETCK QQLTHEKSGC NSEQTSNDDV  60
VPVLEEFMPI KRAADSDSDQ DQDQSEEIRN IGNFDINSKK SDWLKSVQLW NQTPDPPSKQ  120
DSPRKSDVVE VKKNGAFHPF KKAKSGGGGP ITGAAQPAST SSTAETGGGN GQSQNRKARR  180
CWSPELHRRF LQAIQQLGGG HVGTPKQIRE LMKVDGLTND EVKSHLQKYR LHTRRPSTTI  240
HNNNTQAPQF VVVGGIWMQP EYAAMATTAT SVEESGSGGG AAASKGIYAP VAAAAPPPPF  300
REAKHKPSSS HSSDGGGARS YSPATSSSTH TQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077211.11e-133PREDICTED: uncharacterized protein LOC105161268
TrEMBLA0A022RLG11e-179A0A022RLG1_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-87G2-like family protein